Structure of PDB 8htx Chain B Binding Site BS01

Receptor Information
>8htx Chain B (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDY
LFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYRIK
QSIDSKCRTAWRRKQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8htx Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S313 K314 R321
Binding residue
(residue number reindexed from 1)		S105 K106 R113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8htx, PDBe:8htx, PDBj:8htx
PDBsum8htx
PubMed37086783
UniProtQ8N9N5|BANP_HUMAN Protein BANP (Gene Name=BANP)

[Back to BioLiP]