Structure of PDB 8hsv Chain B Binding Site BS01

Receptor Information
>8hsv Chain B (length=363) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRV
YVTLTVAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQER
LIKKLGEHAYPFTFEIPPNLPSSVTLQPGPEDTGKALGVDYEVKAFVAEN
LEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASL
DKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADIVLFNTAQYKVPV
AMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNLASS
TLLREGANREILGIIVSYKVKVKLVVSRGGASSDVAVELPFTLMHPKPKE
EDDDIVFEDFARQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hsv GPCR targeting of E3 ubiquitin ligase MDM2 by inactive beta-arrestin.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L191 K226 S330 R331 A339 S341 D342
Binding residue
(residue number reindexed from 1)		L188 K223 S327 R328 A331 S333 D334
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0005096 GTPase activator activity
GO:0005102 signaling receptor binding
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030276 clathrin binding
GO:0030331 nuclear estrogen receptor binding
GO:0031434 mitogen-activated protein kinase kinase binding
GO:0031625 ubiquitin protein ligase binding
GO:0031691 alpha-1A adrenergic receptor binding
GO:0031692 alpha-1B adrenergic receptor binding
GO:0031701 angiotensin receptor binding
GO:0031762 follicle-stimulating hormone receptor binding
GO:0031896 V2 vasopressin receptor binding
GO:0035612 AP-2 adaptor complex binding
GO:0035615 clathrin adaptor activity
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0044325 transmembrane transporter binding
GO:0045309 protein phosphorylated amino acid binding
GO:0051219 phosphoprotein binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006897 endocytosis
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0008277 regulation of G protein-coupled receptor signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0016567 protein ubiquitination
GO:0031397 negative regulation of protein ubiquitination
GO:0031398 positive regulation of protein ubiquitination
GO:0032715 negative regulation of interleukin-6 production
GO:0032717 negative regulation of interleukin-8 production
GO:0034393 positive regulation of smooth muscle cell apoptotic process
GO:0035025 positive regulation of Rho protein signal transduction
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042699 follicle-stimulating hormone signaling pathway
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043149 stress fiber assembly
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043278 response to morphine
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0045746 negative regulation of Notch signaling pathway
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050975 sensory perception of touch
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0014069 postsynaptic density
GO:0016323 basolateral plasma membrane
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0045211 postsynaptic membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hsv, PDBe:8hsv, PDBj:8hsv
PDBsum8hsv
PubMed37399373
UniProtP29066|ARRB1_RAT Beta-arrestin-1 (Gene Name=Arrb1)

[Back to BioLiP]