Structure of PDB 8hn3 Chain B Binding Site BS01

Receptor Information

>8hn3 Chain B (length=80) Species: 1097 (Chlorobaculum tepidum)

MAEGKTIYEGGCNACHDAGMMGAPKPGDKAAWAPRIAKGEESVIKNTING
LNGMPPKGGNAALTDEQLTNAAKYLISISK

Ligand information

• Ligand ID: HEC
• InChI: InChI=1S/C34H34N4O4.Fe/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,9-12H2,1-6H3,(H,39,40)(H,41,42);/q-4;+4/b21-7?,22-8?,26-13-,29-14-,30-15-,31-16-;
• InChIKey: HXQIYSLZKNYNMH-LJNAALQVSA-N
• SMILES:
  ACDLabs 10.04: O=C(O)CCC1=C(C2=CC6=C(C(=C/C)\C5=CC4=C(C(\C3=Cc7c(c(c8C=C1N2[Fe](N34)(N56)n78)CCC(=O)O)C)=C/C)C)C)C
  OpenEye OEToolkits 1.5.0: CC=C1C(=C2C=C3C(=CC)C(=C4N3[Fe]56N2C1=Cc7n5c(c(c7C)CCC(=O)O)C=C8N6C(=C4)C(=C8CCC(=O)O)C)C)C
  CACTVS 3.341: C\C=C1/C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)\C7=C/C)C=C1N2[Fe@@]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
  CACTVS 3.341: CC=C1C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)C7=CC)C=C1N2[Fe]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
• Formula: C34 H34 Fe N4 O4
• Name: HEME C
• PDB chain: 8hn3 Chain B Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8hn3 Soluble domains of cytochrome c-556 and Rieske iron-sulfur protein from Chlorobaculum tepidum: Crystal structures and interaction analysis.
• Resolution: 1.65 Å
• Binding residue (original residue number in PDB): C11 C14 H15 M20 A22 P23 W31 R34 V42 N45 T46 L50 N51 M53 P54 G57
• Binding residue (residue number reindexed from 1): C12 C15 H16 M21 A23 P24 W32 R35 V43 N46 T47 L51 N52 M54 P55 G58
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

External links

• PDB: RCSB:8hn3, PDBe:8hn3, PDBj:8hn3
• PDBsum: 8hn3
• PubMed: 37180033
• UniProt: Q8KG95