Structure of PDB 8hmz Chain B Binding Site BS01

Receptor Information
>8hmz Chain B (length=264) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPL
LLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSAL
AAEARETRRQELLEKITEGQAAKKQKLEQASGASPRSALLVQLATARPRP
VKARPLDWRVQSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDF
LVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQ
PDGKVVYTSLQWAS
Ligand information
>8hmz Chain 5 (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcucuguggcgcaauggauagcgcauuggacuucuauagagca
..........<<<<........>>>>........<<<..>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hmz Structural basis of pre-tRNA intron removal by human tRNA splicing endonuclease.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R41 R105 K239 Y247 H255 A256 R285 K286
Binding residue
(residue number reindexed from 1)		R41 R105 K195 Y203 H211 A212 R241 K242
Enzymatic activity
Enzyme Commision number 4.6.1.16: tRNA-intron lyase.
Gene Ontology
Molecular Function
GO:0000213 tRNA-intron endonuclease activity
GO:0003676 nucleic acid binding
GO:0016829 lyase activity
Biological Process
GO:0000379 tRNA-type intron splice site recognition and cleavage
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
GO:0006397 mRNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0000214 tRNA-intron endonuclease complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hmz, PDBe:8hmz, PDBj:8hmz
PDBsum8hmz
PubMed37028420
UniProtQ9BSV6|SEN34_HUMAN tRNA-splicing endonuclease subunit Sen34 (Gene Name=TSEN34)

[Back to BioLiP]