Structure of PDB 8hib Chain B Binding Site BS01

Receptor Information
>8hib Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPG
FLHSWWCVFWDLYCAAPE
Ligand information
>8hib Chain D (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTEFAPPPTPMVDHLVASNPFEDD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hib The crystal structure of Pygo2-LDB1-SSBP2 triple complex
Resolution2.45 Å
Binding residue
(original residue number in PDB)		R19 E20 Y25 E28 I46 W48 N51 T53 G55 F60
Binding residue
(residue number reindexed from 1)		R10 E11 Y16 E19 I37 W39 N42 T44 G46 F51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding

View graph for
Molecular Function
External links
PDB RCSB:8hib, PDBe:8hib, PDBj:8hib
PDBsum8hib
PubMed
UniProtP81877|SSBP2_HUMAN Single-stranded DNA-binding protein 2 (Gene Name=SSBP2)

[Back to BioLiP]