Structure of PDB 8heq Chain B Binding Site BS01

Receptor Information
>8heq Chain B (length=159) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSIGLVIDKKEKVIDAKPLNNDAKPILDEAAPKDMPLYDALSKILDISKK
NGYINSADNIVLFSASINSGRNNVSESDKGIQEIISTLKDVAKDAGVKFE
IIPSTEEDRQKALDQNLSMGRYAIYVKAVEEGVNLNLEDARNLSVSEILG
KLEHHHHHH
Ligand information
>8heq Chain A (length=10) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MYAYIDVDIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8heq Essential autoproteolysis of bacterial anti-sigma factor RsgI for transmembrane signal transduction.
ResolutionN/A
Binding residue
(original residue number in PDB)		P11 S12 I13 G14 L15 V16 I17 D18 K27 I54 L55 S58 Y63 I64 V71 L72 F73 S74 A75 S76 I77 N78 G80 R81 E86 G90 R119 S128 M129 G130 R131 S154 V155
Binding residue
(residue number reindexed from 1)		P1 S2 I3 G4 L5 V6 I7 D8 K17 I44 L45 S48 Y53 I54 V61 L62 F63 S64 A65 S66 I67 N68 G70 R71 E76 G80 R109 S118 M119 G120 R121 S144 V145
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8heq, PDBe:8heq, PDBj:8heq
PDBsum8heq
PubMed37418529
UniProtA3DC27|RSGI2_ACET2 Anti-sigma-I factor RsgI2 (Gene Name=rsgI2)

[Back to BioLiP]