Structure of PDB 8heo Chain B Binding Site BS01

Receptor Information

>8heo Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLD
AVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLV
LEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRS
IHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Ligand information

>8heo Chain G (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EMTPVEPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8heo Crystal structure of SIAH1 SBD bound to Axin2 peptide
Resolution	2.53 Å
Binding residue (original residue number in PDB)	T156 L158 V164 F165 L166 T168 A175 D177 W178
Binding residue (residue number reindexed from 1)	T64 L66 V72 F73 L74 T76 A83 D85 W86

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding

	Biological Process
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007275	multicellular organism development

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8heo, PDBe:8heo, PDBj:8heo
PDBsum	8heo
PubMed
UniProt	Q8IUQ4\|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 (Gene Name=SIAH1)

[Back to BioLiP]