Structure of PDB 8hbm Chain B Binding Site BS01

Receptor Information
>8hbm Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDM
YMRRKCQECRLRKCKEMGMLAEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hbm Structural basis of the farnesoid X receptor/retinoid X receptor heterodimer on inverted repeat DNA
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E145 R153 R176 R177 Q180 R183
Binding residue
(residue number reindexed from 1)		E22 R30 R53 R54 Q57 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8hbm, PDBe:8hbm, PDBj:8hbm
PDBsum8hbm
PubMed37287811
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]