Structure of PDB 8gdv Chain B Binding Site BS01

Receptor Information
>8gdv Chain B (length=192) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIVQNLMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLN
TMLNTVGGHQAAIQMLKETINEEAAEWDRLHPREPRGSDIAGTTSTLQEQ
IGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQPKEPFRDYV
DRFYKTLRAEQATETLLVQNANPDCKTILKALTLEEMMTACQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gdv Structure of M66I mutant of disulfide stabilized HIV-1 CA hexamer in complex with CPSF6 peptide and IP6
Resolution3.3 Å
Binding residue
(original residue number in PDB)		N53 L56 N57 I66 Q67 K70 N74 S102 T107
Binding residue
(residue number reindexed from 1)		N50 L53 N54 I63 Q64 K67 N71 S88 T93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Biological Process
External links
PDB RCSB:8gdv, PDBe:8gdv, PDBj:8gdv
PDBsum8gdv
PubMed
UniProtP12493|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]