Structure of PDB 8g57 Chain B Binding Site BS01

Receptor Information
>8g57 Chain B (length=85) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR
DAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8g57 Chain I (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g57 Cryo-EM structure of the human Sirtuin 6-nucleosome complex.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		R45 I46 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R28 I29 G31 R61 K62 T63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8g57, PDBe:8g57, PDBj:8g57
PDBsum8g57
PubMed37058572
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]