Structure of PDB 8fyu Chain B Binding Site BS01

Receptor Information
>8fyu Chain B (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYL
KMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAY
SLAKEQRLNFGDDIPSALRIAKKKRWNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fyu Phosphorylation of a Cleaved Tau Proteoform at a Single Residue Inhibits Binding to the E3 Ubiquitin Ligase, CHIP.
Resolution1.84839 Å
Binding residue
(original residue number in PDB)		K31 N35 F38 Y50 N66 L69 K73 K96 F99 N131 F132 G133 D135
Binding residue
(residue number reindexed from 1)		K9 N13 F16 Y28 N44 L47 K51 K74 F77 N109 F110 G111 D113
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8fyu, PDBe:8fyu, PDBj:8fyu
PDBsum8fyu
PubMed37645969
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]