Structure of PDB 8fik Chain B Binding Site BS01

Receptor Information
>8fik Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQA
KNLLCGFYGRHAALRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGE
VRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFK
HCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fik DNA-based inhibitors restrict mutagenic activity of APOBEC3 in cells
Resolution1.912 Å
Binding residue
(original residue number in PDB)
I26 R28 H29 K30 T31 N57 A59 K60 H70 W98 S99 Y130 D131 Y132
Binding residue
(residue number reindexed from 1)
I17 R19 H20 K21 T22 N48 A50 K51 H61 W89 S90 Y121 D122 Y123
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0010526 retrotransposon silencing
GO:0016554 cytidine to uridine editing
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0044355 clearance of foreign intracellular DNA
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fik, PDBe:8fik, PDBj:8fik
PDBsum8fik
PubMed37821454
UniProtP31941|ABC3A_HUMAN DNA dC->dU-editing enzyme APOBEC-3A (Gene Name=APOBEC3A)

[Back to BioLiP]