Structure of PDB 8fif Chain B Binding Site BS01

Receptor Information
>8fif Chain B (length=118) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTLKESGGGLVQPGGSLRLSCAASGGISRVNVAGWYRQAPGQQREMVAVI
RSGGRINYADFVKGRFTFSRDDAKQTIYLQMDNLKSEDTAVYYCYGSLLE
TGTFQYREYWGQGTQVTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fif A2.3 Nanobody In Complex With Microcystin-LR
Resolution2.35 Å
Binding residue
(original residue number in PDB)		A26 I30 S31 V33 S55 R73 D75 Q78 T79 I80 L101
Binding residue
(residue number reindexed from 1)		A23 I27 S28 V30 S52 R70 D72 Q75 T76 I77 L98
External links