Structure of PDB 8fax Chain B Binding Site BS01

Receptor Information
>8fax Chain B (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTLTQSPGTLSLSPGDRATLSCRASQTIRISYLAWYQQKPGQAPRLLVYG
PSIRATGIPDRFSARGSGTDFTLTISRLEPEDFAVYYCQHYGSSPPRYTF
GQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW
KVDNALQSGNSQESVTEQDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC
Ligand information
>8fax Chain L (length=12) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFQDELDEFFKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fax Structure and epitope of a neutralizing monoclonal antibody that targets the stem helix of beta coronaviruses.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y33 Y92 G93 S94 P97
Binding residue
(residue number reindexed from 1)		Y32 Y91 G92 S93 P96
External links