Structure of PDB 8f5y Chain B Binding Site BS01

Receptor Information
>8f5y Chain B (length=237) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVKVSLQLRGEDGSVW
NYKPPSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFE
LCQLRFNTVFNAETGTWECGRLSYCLEPMLKFHYMLKKLQLHEEEYVLMQ
AISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIM
AMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f5y A bromodomain-independent mechanism of gene regulation by the BET inhibitor JQ1: direct activation of nuclear receptor PXR.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		K259 I269 K277 E427
Binding residue
(residue number reindexed from 1)		K77 I87 K95 E233
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8f5y, PDBe:8f5y, PDBj:8f5y
PDBsum8f5y
PubMed38084912
UniProtO75469|NR1I2_HUMAN Nuclear receptor subfamily 1 group I member 2 (Gene Name=NR1I2)

[Back to BioLiP]