Structure of PDB 8f5g Chain B Binding Site BS01

Receptor Information
>8f5g Chain B (length=144) Species: 496866 (Thermoanaerobacter pseudethanolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WYVIFTRSGYENKVRDIIECFKEEVKLLIPKRKIIERVKGQPVEKIKLLF
PGYVFVNAEMSDDLYYPAFVKEEEMKIILSLTKNSDLIDLSKGIMEGERV
KIIEGPLKGYEGLIKKIDKRKKRAKVIFSIAGELKSVDLAIEVM
Ligand information
>8f5g Chain D (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaaucgcugcuucggcacguugcc
<<<<<.<<.<<<....>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f5g NusG-RNA complex
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F90 E93 E94
Binding residue
(residue number reindexed from 1)		F69 E72 E73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling

View graph for
Biological Process
External links
PDB RCSB:8f5g, PDBe:8f5g, PDBj:8f5g
PDBsum8f5g
PubMed38959899
UniProtB0KAR9

[Back to BioLiP]