Structure of PDB 8f15 Chain B Binding Site BS01

Receptor Information
>8f15 Chain B (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEE
Ligand information
>8f15 Chain E (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PWWECLSQADDCDFR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f15 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution1.73 Å
Binding residue
(original residue number in PDB)
Q27 K30 V61 K95 F98 Q102 L105 F131 D134 I135 S137 A138 I141
Binding residue
(residue number reindexed from 1)
Q7 K10 V41 K75 F78 Q82 L85 F111 D114 I115 S117 A118 I121
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f15, PDBe:8f15, PDBj:8f15
PDBsum8f15
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]