Structure of PDB 8etd Chain B Binding Site BS01

Receptor Information
>8etd Chain B (length=177) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHV
ELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEV
LHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGA
YKYLECSAKTNEGVREVFESATRAAML
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain8etd Chain B Residue 301 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etd Crystal Structure of Schizosaccharomyces pombe Rho1 Reveals Its Evolutionary Relationship with Other Rho GTPases.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		T19 T37
Binding residue
(residue number reindexed from 1)		T16 T34
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
GO:0019901 protein kinase binding
GO:0035591 signaling adaptor activity
Biological Process
GO:0007015 actin filament organization
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0030100 regulation of endocytosis
GO:0032955 regulation of division septum assembly
GO:0032956 regulation of actin cytoskeleton organization
GO:0032995 regulation of fungal-type cell wall biogenesis
GO:0060635 positive regulation of (1->3)-beta-D-glucan biosynthetic process
GO:0070610 regulation of fungal-type cell wall (1->3)-alpha-glucan biosynthetic process
GO:0090334 regulation of cell wall (1->3)-beta-D-glucan biosynthetic process
GO:0140281 positive regulation of mitotic division septum assembly
GO:0140748 positive regulation of regulation of ascospore wall (1->3)-beta-D-glucan biosynthetic process
GO:1905758 positive regulation of primary cell septum biogenesis
GO:2000769 regulation of establishment or maintenance of cell polarity regulating cell shape
Cellular Component
GO:0000935 division septum
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane
GO:0031097 medial cortex
GO:0032153 cell division site
GO:0035838 growing cell tip
GO:0140453 protein aggregate center
GO:1902716 cell cortex of growing cell tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etd, PDBe:8etd, PDBj:8etd
PDBsum8etd
PubMed36358328
UniProtQ09914|RHO1_SCHPO GTP-binding protein rho1 (Gene Name=rho1)

[Back to BioLiP]