Structure of PDB 8enk Chain B Binding Site BS01

Receptor Information
>8enk Chain B (length=381) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGM
GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNV
KVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHF
ILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFM
QDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF
VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVA
TNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSD
ENDAKILNDVQDRFEVNISELPDEIDISSYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8enk Structural basis for high-order complex of SARNP and DDX39B to facilitate mRNP assembly.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H121 R123 G150 G151 T172 G174 R175 Q204 M207 S296 V297 R319 T344 L346
Binding residue
(residue number reindexed from 1)		H78 R80 G107 G108 T129 G131 R132 Q161 M164 S253 V254 R276 T301 L303
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003729 mRNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008186 ATP-dependent activity, acting on RNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017070 U6 snRNA binding
GO:0030621 U4 snRNA binding
GO:0042802 identical protein binding
GO:0043008 ATP-dependent protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006405 RNA export from nucleus
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0010501 RNA secondary structure unwinding
GO:0051028 mRNA transport
Cellular Component
GO:0000346 transcription export complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0005688 U6 snRNP
GO:0005737 cytoplasm
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8enk, PDBe:8enk, PDBj:8enk
PDBsum8enk
PubMed37578863
UniProtQ13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B (Gene Name=DDX39B)

[Back to BioLiP]