Structure of PDB 8eka Chain B Binding Site BS01

Receptor Information
>8eka Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQMTQSPSTLSASVGDRVTITCRASQFISRWLAWYQQKPGKAPKLLIYKA
SSLESGVPSRFSGSGSETHFTLTISSLQPDDVATYYCQEYTSYGRTFGQG
TKVEIKR
Ligand information
>8eka Chain P (length=27) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NANPNVDPNANPNVDPNANPNVDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eka Cryo-EM structures of anti-malarial antibody L9 with circumsporozoite protein reveal trimeric L9 association and complete 27-residue epitope.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		W32 R96
Binding residue
(residue number reindexed from 1)		W31 R95
External links