Structure of PDB 8ejo Chain B Binding Site BS01

Receptor Information

>8ejo Chain B (length=56) Species: 9258 (Ornithorhynchus anatinus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRKRTTFNKTQLEILVKSFNKDPYPGIGVREHLASLIQIPESRIQVWFQ
NRRARQ

Ligand information

>8ejo Chain C (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcgtaatctaatcaaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ejo Antagonism among DUX family members evolved from an ancestral toxic single homeodomain protein.
Resolution	2.67 Å
Binding residue (original residue number in PDB)	R22 Y45 Q70 R73
Binding residue (residue number reindexed from 1)	R2 Y25 Q50 R53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:8ejo, PDBe:8ejo, PDBj:8ejo
PDBsum	8ejo
PubMed	37744032
UniProt	A0A6I8NF41

[Back to BioLiP]