Structure of PDB 8eic Chain B Binding Site BS01

Receptor Information
>8eic Chain B (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHI
VYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
>8eic Chain C (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QVCYQAAWQCLSDDWD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eic Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides
Resolution2.62 Å
Binding residue
(original residue number in PDB)
T26 M50 L54 G58 I61 Q72 V93 H96 Y100 Y104
Binding residue
(residue number reindexed from 1)
T2 M26 L30 G34 I37 Q48 V69 H72 Y76 Y80
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8eic, PDBe:8eic, PDBj:8eic
PDBsum8eic
PubMed37914719
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]