Structure of PDB 8eia Chain B Binding Site BS01

Receptor Information
>8eia Chain B (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eia Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K51 L54 I61 Q72 V93 K94 H96 Y100
Binding residue
(residue number reindexed from 1)		K26 L29 I36 Q47 V68 K69 H71 Y75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eia, PDBe:8eia, PDBj:8eia
PDBsum8eia
PubMed37914719
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]