Structure of PDB 8e9a Chain B Binding Site BS01

Receptor Information

>8e9a Chain B (length=175) Species: 10498 (African swine fever virus BA71V) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLND
VDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQL
DLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLV
PLKITTEKELIKELGFTYRIPKKRL

Ligand information

>8e9a Chain D (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctgggatacattgtgaaagcacaatgggctagctacaacgaatcccagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8e9a Structure of a 10-23 deoxyribozyme exhibiting a homodimer conformation.
Resolution	2.69 Å
Binding residue (original residue number in PDB)	D49 D51 C81 G82 E83 R84 K85 H115 F116 G118 V120 L123 I124 R127 K131 K136 L137 N138 Y140
Binding residue (residue number reindexed from 1)	D50 D52 C82 G83 E84 R85 K86 H116 F117 G119 V121 L124 I125 R128 K132 K137 L138 N139 Y141

Enzymatic activity

Enzyme Commision number

2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0016779	nucleotidyltransferase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006259	DNA metabolic process
GO:0006281	DNA repair
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0071897	DNA biosynthetic process

	Cellular Component
GO:0044423	virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8e9a, PDBe:8e9a, PDBj:8e9a
PDBsum	8e9a
PubMed	37301907
UniProt	P42494\|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)

[Back to BioLiP]