Structure of PDB 8e40 Chain B Binding Site BS01

Receptor Information
>8e40 Chain B (length=118) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKISS
EVHIPLGDAKLVITTYWGLGQGVSIEWRKKRYSTQVDPDLADQLIHLHYF
DCKQIKPPLPSVRKLTED
Ligand information
>8e40 Chain r (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuaaaaaaaaaaaaaaaaa
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e40 Structural basis for HIV-1 antagonism of host APOBEC3G via Cullin E3 ligase.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		R23 K26 Y30 I31 H42 H43
Binding residue
(residue number reindexed from 1)		R20 K23 Y27 I28 H39 H40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0019058 viral life cycle
Cellular Component
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e40, PDBe:8e40, PDBj:8e40
PDBsum8e40
PubMed36598981
UniProtP12504|VIF_HV1N5 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]