Structure of PDB 8e3d Chain B Binding Site BS01

Receptor Information
>8e3d Chain B (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKV
HMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVR
SDHLHRHLKKDGCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3d Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution2.62 Å
Binding residue
(original residue number in PDB)		K389 Q392 R399 H400 T403 R421 Y451 R458 R464 K473 V476 R477 H480 R483
Binding residue
(residue number reindexed from 1)		K12 Q15 R22 H23 T26 R44 Y74 R81 R87 K96 V99 R100 H103 R106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8e3d, PDBe:8e3d, PDBj:8e3d
PDBsum8e3d
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]