Structure of PDB 8dtx Chain B Binding Site BS01

Receptor Information
>8dtx Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIVLTQSPGTLSLSPGERATLSCRASQSVRRNYFAWYQQKRGQAPRLLIY
DASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYDSSPPMYI
FGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGE
Ligand information
>8dtx Chain G (length=15) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDSFKEELDKYFKNH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtx Rare, convergent antibodies targeting the stem helix broadly neutralize diverse betacoronaviruses.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
R30 R31 Y33 Y92 D93 S94 P96 P97 Y99
Binding residue
(residue number reindexed from 1)
R30 R31 Y33 Y92 D93 S94 P96 P97 Y99
External links