Structure of PDB 8dtm Chain B Binding Site BS01

Receptor Information
>8dtm Chain B (length=340) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQN
VVVDIDPPQRSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDII
YVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQA
EDSELFELDYCLKGLKLPSRKELEESSFRKTFEDYLHHRPFEKVVNKESL
VISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKADDIVGPV
THEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFAL
ERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDY
Ligand information
>8dtm Chain C (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLEEEWAQIECEVYGRGC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtm Activation of the insulin receptor by an insulin mimetic peptide.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R479 L486 R488 P537 Q538 G552 W553 L554 R556
Binding residue
(residue number reindexed from 1)		R15 L22 R24 P58 Q59 G64 W65 L66 R68
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0004714 transmembrane receptor protein tyrosine kinase activity
GO:0005009 insulin receptor activity
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0019904 protein domain specific binding
GO:0030295 protein kinase activator activity
GO:0031994 insulin-like growth factor I binding
GO:0031995 insulin-like growth factor II binding
GO:0043548 phosphatidylinositol 3-kinase binding
GO:0043559 insulin binding
GO:0043560 insulin receptor substrate binding
GO:0044877 protein-containing complex binding
GO:0051425 PTB domain binding
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002092 positive regulation of receptor internalization
GO:0003007 heart morphogenesis
GO:0006355 regulation of DNA-templated transcription
GO:0006468 protein phosphorylation
GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0008286 insulin receptor signaling pathway
GO:0008544 epidermis development
GO:0008584 male gonad development
GO:0009887 animal organ morphogenesis
GO:0016310 phosphorylation
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0030238 male sex determination
GO:0030325 adrenal gland development
GO:0030335 positive regulation of cell migration
GO:0031017 exocrine pancreas development
GO:0031623 receptor internalization
GO:0032148 activation of protein kinase B activity
GO:0032869 cellular response to insulin stimulus
GO:0042593 glucose homeostasis
GO:0043406 positive regulation of MAP kinase activity
GO:0043410 positive regulation of MAPK cascade
GO:0045429 positive regulation of nitric oxide biosynthetic process
GO:0045725 positive regulation of glycogen biosynthetic process
GO:0045821 positive regulation of glycolytic process
GO:0045840 positive regulation of mitotic nuclear division
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0046326 positive regulation of D-glucose import
GO:0046718 symbiont entry into host cell
GO:0046777 protein autophosphorylation
GO:0048639 positive regulation of developmental growth
GO:0051446 positive regulation of meiotic cell cycle
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060267 positive regulation of respiratory burst
GO:0071363 cellular response to growth factor stimulus
GO:2000194 regulation of female gonad development
Cellular Component
GO:0005635 nuclear envelope
GO:0005764 lysosome
GO:0005768 endosome
GO:0005770 late endosome
GO:0005886 plasma membrane
GO:0005899 insulin receptor complex
GO:0005901 caveola
GO:0016020 membrane
GO:0031981 nuclear lumen
GO:0043235 receptor complex
GO:0055038 recycling endosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dtm, PDBe:8dtm, PDBj:8dtm
PDBsum8dtm
PubMed36151101
UniProtP15208|INSR_MOUSE Insulin receptor (Gene Name=Insr)

[Back to BioLiP]