Structure of PDB 8dqz Chain B Binding Site BS01

Receptor Information
>8dqz Chain B (length=318) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLSLQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGI
GKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHL
PPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEP
LQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMR
QAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILR
TDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGV
GTYLQLASMLAKIHKLNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dqz Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		G85 I86
Binding residue
(residue number reindexed from 1)		G82 I83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006281 DNA repair
GO:0007062 sister chromatid cohesion
GO:0007064 mitotic sister chromatid cohesion
GO:0090618 DNA clamp unloading
Cellular Component
GO:0005634 nucleus
GO:0005663 DNA replication factor C complex
GO:0005829 cytosol
GO:0031389 Rad17 RFC-like complex
GO:0031390 Ctf18 RFC-like complex
GO:0031391 Elg1 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dqz, PDBe:8dqz, PDBj:8dqz
PDBsum8dqz
PubMed35939393
UniProtP40339|RFC4_YEAST Replication factor C subunit 4 (Gene Name=RFC4)

[Back to BioLiP]