Structure of PDB 8do8 Chain B Binding Site BS01

Receptor Information
>8do8 Chain B (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLA
IKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMN
EKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRI
YFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8do8 Structural basis for ATG9A recruitment to the ULK1 complex in mitophagy initiation.
Resolution2.41 Å
Binding residue
(original residue number in PDB)
K15 F16 K18 F19 G47 W50 Y115 Y118
Binding residue
(residue number reindexed from 1)
K11 F12 K14 F15 G43 W46 Y111 Y114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000045 autophagosome assembly
GO:0006914 autophagy
Cellular Component
GO:1990316 Atg1/ULK1 kinase complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8do8, PDBe:8do8, PDBj:8do8
PDBsum8do8
PubMed36791199
UniProtO75143|ATG13_HUMAN Autophagy-related protein 13 (Gene Name=ATG13)

[Back to BioLiP]