Structure of PDB 8dnq Chain B Binding Site BS01

Receptor Information
>8dnq Chain B (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPM
DMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEK
IFLQKVASMPQEEQEL
Ligand information
>8dnq Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WYSKKYAKWWTVYPC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dnq BRD2-BD1 in complex with cyclic peptide 2.2B
Resolution1.84 Å
Binding residue
(original residue number in PDB)		W97 Q101 V103 K107 L108 N156 D160 D161 I162 M165
Binding residue
(residue number reindexed from 1)		W26 Q30 V32 K36 L37 N85 D89 D90 I91 M94
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8dnq, PDBe:8dnq, PDBj:8dnq
PDBsum8dnq
PubMed37269828
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]