Structure of PDB 8dgw Chain B Binding Site BS01

Receptor Information
>8dgw Chain B (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLTQPPSVSAAPERKVTISCSGSSSNIGTNFVSWYQQLPGTAPKLLIYEN
NKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGAWDSTPGTWVFG
GGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGST
VEKTVAP
Ligand information
>8dgw Chain I (length=20) Species: 443239 (Human coronavirus HKU1 (isolate N1)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSVPKLSDFESELSHWFKNQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dgw Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease.
Resolution2.81 Å
Binding residue
(original residue number in PDB)
G29 T30 N31 F32 K66 W91 W96
Binding residue
(residue number reindexed from 1)
G28 T29 N30 F31 K65 W90 W97
External links