Structure of PDB 8dgo Chain B Binding Site BS01

Receptor Information
>8dgo Chain B (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIP
KNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSV
KFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLR
DIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACH
GQTGMFPRNYVTPVNRNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dgo Structural mapping of PEAK pseudokinase interactions identifies 14-3-3 as a molecular switch for PEAK3 signaling.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R67 R86 S96 Q106 H107 F108 K109 W121
Binding residue
(residue number reindexed from 1)		R68 R87 S97 Q107 H108 F109 K110 W122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0003723 RNA binding
GO:0005068 transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005091 guanyl-nucleotide exchange factor adaptor activity
GO:0005154 epidermal growth factor receptor binding
GO:0005168 neurotrophin TRKA receptor binding
GO:0005515 protein binding
GO:0017124 SH3 domain binding
GO:0019901 protein kinase binding
GO:0019903 protein phosphatase binding
GO:0019904 protein domain specific binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043560 insulin receptor substrate binding
GO:0046875 ephrin receptor binding
Biological Process
GO:0007165 signal transduction
GO:0007173 epidermal growth factor receptor signaling pathway
GO:0007265 Ras protein signal transduction
GO:0008286 insulin receptor signaling pathway
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0014044 Schwann cell development
GO:0030036 actin cytoskeleton organization
GO:0030838 positive regulation of actin filament polymerization
GO:0031623 receptor internalization
GO:0035987 endodermal cell differentiation
GO:0042110 T cell activation
GO:0042267 natural killer cell mediated cytotoxicity
GO:0042552 myelination
GO:0042770 signal transduction in response to DNA damage
GO:0043408 regulation of MAPK cascade
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048646 anatomical structure formation involved in morphogenesis
GO:0050853 B cell receptor signaling pathway
GO:0060670 branching involved in labyrinthine layer morphogenesis
GO:0071479 cellular response to ionizing radiation
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0005938 cell cortex
GO:0008180 COP9 signalosome
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0070062 extracellular exosome
GO:0070436 Grb2-EGFR complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dgo, PDBe:8dgo, PDBj:8dgo
PDBsum8dgo
PubMed37336884
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]