Structure of PDB 8daf Chain B Binding Site BS01

Receptor Information

>8daf Chain B (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PNVPELILQLLQLEPDEDQVRARILGSLQEPTDQPAAFGLLCRMADQTFI
SIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSIL
LVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLALQLDRQEFVCLKFI
ILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHSGDKFQQLLLCLV
EVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAK

Ligand information

>8daf Chain D (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENALLRYLLDK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8daf Comparison of activity, structure, and dynamics of SF-1 and LRH-1 complexed with small molecule modulators.
Resolution	2.59 Å
Binding residue (original residue number in PDB)	R281 M295 E454
Binding residue (residue number reindexed from 1)	R57 M71 E230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:8daf, PDBe:8daf, PDBj:8daf
PDBsum	8daf
PubMed	37328104
UniProt	Q13285\|STF1_HUMAN Steroidogenic factor 1 (Gene Name=NR5A1)

[Back to BioLiP]