Structure of PDB 8d96 Chain B Binding Site BS01

Receptor Information
>8d96 Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLT
LEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLK
IILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTH
YQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d96 Structures of human primosome elongation complexes.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		H300 R302 H303 R306 Y345
Binding residue
(residue number reindexed from 1)		H31 R33 H34 R37 Y76
Enzymatic activity
Enzyme Commision number 2.7.7.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
GO:1903934 positive regulation of DNA primase activity
Cellular Component
GO:0005654 nucleoplasm
GO:0005658 alpha DNA polymerase:primase complex
GO:1990077 primosome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d96, PDBe:8d96, PDBj:8d96
PDBsum8d96
PubMed37069376
UniProtP49643|PRI2_HUMAN DNA primase large subunit (Gene Name=PRIM2)

[Back to BioLiP]