Structure of PDB 8d47 Chain B Binding Site BS01

Receptor Information
>8d47 Chain B (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGVVQPGGSLRLSCAASGFNFNNYALHWVRQAPGKGLEWVAI
ISYEARNKKYGVSVMGRFSISRDNSKSIMYLEMNSLRVEDTGVYYCARDL
FLSDYDRSGYDPTRGGFDHWGQGTLVTVSSASTKGPSVFPLAPSSKTSGG
TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV
PSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Ligand information
>8d47 Chain D (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKRSFIEDLLFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d47 Human neutralizing antibodies to cold linear epitopes and subdomain 1 of the SARS-CoV-2 spike glycoprotein.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N31 Y52A E53 R55 N56 K57 L98 S99 Y100A
Binding residue
(residue number reindexed from 1)		N31 Y53 E54 R56 N57 K58 L102 S103 Y105
External links