Structure of PDB 8cx1 Chain B Binding Site BS01

Receptor Information
>8cx1 Chain B (length=176) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPR
ISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP
ELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLAL
AALITPKKIKPPLPSVTKLTEDRWNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cx1 The structural basis for HIV-1 Vif antagonism of human APOBEC3G.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T20 K22 S23 K26 H27 Y30 V31 Y40 H42 Y44
Binding residue
(residue number reindexed from 1)		T20 K22 S23 K26 H27 Y30 V31 Y40 H42 Y44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0019058 viral life cycle
GO:0019079 viral genome replication
GO:0039537 symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0075528 perturbation by virus of host immune response
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cx1, PDBe:8cx1, PDBj:8cx1
PDBsum8cx1
PubMed36754086
UniProtP69723|VIF_HV1H2 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]