Structure of PDB 8cx0 Chain B Binding Site BS01

Receptor Information

>8cx0 Chain B (length=176) Species: 11676 (Human immunodeficiency virus 1)

MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPR
ISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP
ELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLAL
AALITPKKIKPPLPSVTKLTEDRWNK

Ligand information

>8cx0 Chain K (length=8)

aaaaaaaa

........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8cx0 The structural basis for HIV-1 Vif antagonism of human APOBEC3G.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): S23 K26 H27 Y30 V31 Y40 H42 H43
• Binding residue (residue number reindexed from 1): S23 K26 H27 Y30 V31 Y40 H42 H43

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0030674 protein-macromolecule adaptor activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:1990756 ubiquitin-like ligase-substrate adaptor activity

Biological Process

• GO:0019058 viral life cycle
• GO:0019079 viral genome replication
• GO:0039537 symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0075528 perturbation by virus of host immune response

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0030430 host cell cytoplasm
• GO:0044423 virion component

External links

• PDB: RCSB:8cx0, PDBe:8cx0, PDBj:8cx0
• PDBsum: 8cx0
• PubMed: 36754086
• UniProt: P69723|VIF_HV1H2 Virion infectivity factor (Gene Name=vif)