Structure of PDB 8cv7 Chain B Binding Site BS01

Receptor Information
>8cv7 Chain B (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMD
LSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDV
FEFRYAKMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cv7 Peptide 2.2E in complex with BRD2-BD2
Resolution1.6 Å
Binding residue
(original residue number in PDB)
A367 W370 V376 L381 N429 H433 D434 V435 M438
Binding residue
(residue number reindexed from 1)
A22 W25 V31 L36 N84 H88 D89 V90 M93
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cv7, PDBe:8cv7, PDBj:8cv7
PDBsum8cv7
PubMed37269828
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]