Structure of PDB 8cv4 Chain B Binding Site BS01

Receptor Information
>8cv4 Chain B (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPM
DMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQD
VFEMRFAKMPDEPEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cv4 Peptide 4.2C in complex with BRD4.2
Resolution1.93 Å
Binding residue
(original residue number in PDB)
W374 P375 F376 Y377 L385 L387 H437 E438 V439
Binding residue
(residue number reindexed from 1)
W26 P27 F28 Y29 L37 L39 H89 E90 V91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cv4, PDBe:8cv4, PDBj:8cv4
PDBsum8cv4
PubMed37269828
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]