Structure of PDB 8cmd Chain B Binding Site BS01

Receptor Information
>8cmd Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQN
GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>8cmd Chain C (length=15) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TQLNRALTGIAVEQD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cmd Structural definition of HLA class II-presented SARS-CoV-2 epitopes reveals a mechanism to escape pre-existing CD4 + T cell immunity.
Resolution2.54 Å
Binding residue
(original residue number in PDB)
D57 Y60 W61 L67 R71 T77 Y78 H81 N82
Binding residue
(residue number reindexed from 1)
D57 Y60 W61 L67 R71 T77 Y78 H81 N82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8cmd, PDBe:8cmd, PDBj:8cmd
PDBsum8cmd
PubMed37471227
UniProtD7RIG0

[Back to BioLiP]