Structure of PDB 8cj1 Chain B Binding Site BS01

Receptor Information

>8cj1 Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE

Ligand information

>8cj1 Chain I (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARRI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cj1 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution	2.564 Å
Binding residue (original residue number in PDB)	D37 D58 S59 V60 L61
Binding residue (residue number reindexed from 1)	D37 D58 S59 V60 L61

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cj1, PDBe:8cj1, PDBj:8cj1
PDBsum	8cj1
PubMed	37347155
UniProt	Q9Y294\|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]