Structure of PDB 8che Chain B Binding Site BS01

Receptor Information
>8che Chain B (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPLSSPVTLGQPASISCRSSQSLVHRQGNTYFHWLQQRPGQPPR
LLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCSQSTHVP
YTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSCNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8che HMB-001: A Novel Bispecific Antibody Accumulating and Targeting Endogenous FVIIa to Activated Platelets for Subcutaneous Prophylaxis in Multiple Bleeding Disorders Including Glanzmann Thrombasthenia.
Resolution1.49 Å
Binding residue
(original residue number in PDB)		Y37 H39 Y54 F60 S61 S96 Y101
Binding residue
(residue number reindexed from 1)		Y37 H39 Y54 F60 S61 S96 Y101
External links