Structure of PDB 8c7s Chain B Binding Site BS01

Receptor Information

>8c7s Chain B (length=256) Species: 367830 (Staphylococcus aureus subsp. aureus USA300) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILG
SSLNELLKSQRIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPP
ENRELFIDSRTTIFPILGGGERLGTLVLGRVHDDFNENDLVLGEYAATVI
GMEILREKHSEVEKEARDKAAITMAINSLSYSEKEAIEHIFEELGGTEGL
LIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGTFIKVKKEKFL
DELEKS

Ligand information

>8c7s Chain M (length=30) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctaaattttctgaaaattctgaaaattatc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8c7s Structural insights into CodY activation and DNA recognition.
Resolution	3.05 Å
Binding residue (original residue number in PDB)	S180 S182 T213 S215
Binding residue (residue number reindexed from 1)	S180 S182 T213 S215

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0005525	GTP binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c7s, PDBe:8c7s, PDBj:8c7s
PDBsum	8c7s
PubMed	37326020
UniProt	Q2FHI3\|CODY_STAA3 Global transcriptional regulator CodY (Gene Name=codY)

[Back to BioLiP]