Structure of PDB 8bzl Chain B Binding Site BS01

Receptor Information
>8bzl Chain B (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRN
IHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQY
QEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSD
PSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTM
LSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bzl Peptidic, Blm10-based activators of human 20S proteasome in vitro and in cellulo enhance degradation of proteins connected with neurodegeneration.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		G16 R17 E22 N155
Binding residue
(residue number reindexed from 1)		G15 R16 E21 N154
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bzl, PDBe:8bzl, PDBj:8bzl
PDBsum8bzl
PubMed
UniProtP25789|PSA4_HUMAN Proteasome subunit alpha type-4 (Gene Name=PSMA4)

[Back to BioLiP]