Structure of PDB 8buw Chain B Binding Site BS01

Receptor Information
>8buw Chain B (length=91) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEVIQALIFKDGSLGLSISGGVGSSSFKSGDDGIFVSKIAKGGPCDNEG
TLKIGDKILSVNEISFTGITHEKAVEILKNQSKYMVVVERS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8buw Crystal structure of Trichoplax Scribble PDZ1 domain in complex with Trichoplax Vangl peptide
Resolution2.85 Å
Binding residue
(original residue number in PDB)
L14 L16 S17 I18 S24 S25 S37 K38 H70 V74
Binding residue
(residue number reindexed from 1)
L15 L17 S18 I19 S25 S26 S38 K39 H71 V75
Enzymatic activity
Enzyme Commision number ?
External links