Structure of PDB 8btg Chain B Binding Site BS01

Receptor Information
>8btg Chain B (length=335) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKT
HLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNV
DVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLE
DRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQI
DSNIRELEGALIRVVAYSSLINKDINADLAAEALKDISKPKVITIKEIQR
VVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGG
RDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8btg The bacterial replication origin BUS promotes nucleobase capture.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
R379 R412 D413 T415 T416
Binding residue
(residue number reindexed from 1)
R268 R301 D302 T304 T305
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006275 regulation of DNA replication
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:1990101 DnaA-oriC complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8btg, PDBe:8btg, PDBj:8btg
PDBsum8btg
PubMed38097584
UniProtP05648|DNAA_BACSU Chromosomal replication initiator protein DnaA (Gene Name=dnaA)

[Back to BioLiP]