Structure of PDB 8bc7 Chain B Binding Site BS01

Receptor Information
>8bc7 Chain B (length=104) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRL
IGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLA
EGPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bc7 Identification and structural basis of C-terminal cyclic imides as natural degrons for cereblon.
Resolution1.719 Å
Binding residue
(original residue number in PDB)		N50 P51 F56 F77 S78 W79 W85 I87 H96 W99 Y101
Binding residue
(residue number reindexed from 1)		N31 P32 F37 F58 S59 W60 W66 I68 H77 W80 Y82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:8bc7, PDBe:8bc7, PDBj:8bc7
PDBsum8bc7
PubMed36375252
UniProtA4TVL0

[Back to BioLiP]