Structure of PDB 8bc6 Chain B Binding Site BS01

Receptor Information

>8bc6 Chain B (length=105) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLR
LIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRL
AEGPA

Ligand information

>8bc6 Chain E (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QMQc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8bc6 Identification and structural basis of C-terminal cyclic imides as natural degrons for cereblon.
Resolution	1.72 Å
Binding residue (original residue number in PDB)	N50 F77 W79 W85 I87 H96 W99 Y101
Binding residue (residue number reindexed from 1)	N32 F59 W61 W67 I69 H78 W81 Y83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:8bc6, PDBe:8bc6, PDBj:8bc6
PDBsum	8bc6
PubMed	36375252
UniProt	A4TVL0

[Back to BioLiP]