Structure of PDB 8b8i Chain B Binding Site BS01

Receptor Information
>8b8i Chain B (length=118) Species: 30538 (Vicugna pacos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVQLVESGGGLVQTGGSLRLSCTASGSIGSISVMGWYRQVPGTQYELVA
GISRGGSTWYEDSVKGRFTISRDNAKNTLYLQMNSLKPEDTGMYYCAGGD
YSDRLGSWGQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b8i Nanobody (NbLumSyt1) bound to human Syt1
Resolution2.75 Å
Binding residue
(original residue number in PDB)
V34 M35 Y38 Q45 Y46 G51 I52 S53 S57 W59 G99 Y101 D103 R104 L105 W108
Binding residue
(residue number reindexed from 1)
V34 M35 Y38 Q45 Y46 G51 I52 S53 S57 W59 G99 Y101 D103 R104 L105 W108
External links